PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06877.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 340aa    MW: 38700.8 Da    PI: 7.4445
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06877.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+d+++++G+g +W + +++ g++R++k+c++rw++yl
       KHN06877.1 14 RGPWSPEEDSKLKDYIEKHGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding39.21.6e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd ++  + +  G++ W+ Ia+ ++ gRt++++k++w++
       KHN06877.1  69 GEFSDEEDRIICSLYANIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.444962IPR017930Myb domain
SuperFamilySSF466891.84E-2711109IPR009057Homeodomain-like
SMARTSM007179.0E-131364IPR001005SANT/Myb domain
PfamPF002494.1E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-251569IPR009057Homeodomain-like
CDDcd001672.04E-91662No hitNo description
PROSITE profilePS5129422.46563117IPR017930Myb domain
SMARTSM007176.6E-1267115IPR001005SANT/Myb domain
PfamPF002493.2E-1169111IPR001005SANT/Myb domain
CDDcd001676.77E-870113No hitNo description
Gene3DG3DSA:1.10.10.605.2E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDSKLKDYIE KHGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FSDEEDRIIC SLYANIGSRW SIIAAQLPGR TDNDIKNYWN TKLKRKLMGL  120
LPSSHQRIAP YQQFSSQNPS SFPSHSSLSS SQYRDYYYNS SHHYYIPAPT SSFTCLEPIS  180
APSSNYTNTT TTSNSLSFYQ HQEPLVSVSP RQYYPITDSS MLVFGSETSC SSSDGSCSQV  240
SLGREIKQED MGFQNFMFGD HQNMNKFMNI NHDGGEEYVN QWTQRPNGYI FQTQQTALDY  300
DLEVIKNLIC SNSSSNSNNG YLSVDENKTE EKGVYYNYCN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539432.10.0PREDICTED: transcription factor RAX2-like
TrEMBLA0A0B2PH600.0A0A0B2PH60_GLYSO; Transcription factor RAX2
TrEMBLI1LTM60.0I1LTM6_SOYBN; Uncharacterized protein
STRINGGLYMA12G30140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-77myb domain protein 36
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]